Glp-2 | search
Click here to view Glp-2 news from 60+ newspapers.
Bookmark or Share- Glucagon-like peptide 2 - PubMedGlucagon-like peptide 2 (GLP-2) is a 33 amino acid peptide-encoded carboxyterminal to the sequence of GLP-1 in the proglucagon gene. Both GLP-1 and GLP-2 are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms of action.
- GLP-2: What do we know? What are we going to discover?GLP-2 is a neurondocrine signal arising from the gastrointestinal tract with trophic action. •. The GLP-2 receptor is expressed in the enteric nervous system. •. GLP-2 is a protective signalling during inflammatory state. •. GLP-2 study has led to innovative treatment for Short Bowel Syndrome and could lead to other relevant applications. Abstract.
- A unique hormonal recognition feature of the human glucagon-like ...Glucagon-like peptides (GLP-1 and GLP-2) are two proglucagon-derived intestinal hormones that mediate distinct physiological functions through two related receptors (GLP-1R and GLP-2R) which...
- Glucagon-like peptide-2 - WikipediaGlucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).
- An updated overview of glucagon-like peptide-2 analog trophic therapy ...Human GLP-2 (hGLP-2) is a systemic nutrient peptide hormone derived from proglucagon. It contains 33 amino acids; it is expressed, transcribed, and translated from the glucagon motif; and it is secreted by L-type endocrine cells in the distal small intestine and colon.
More
